Lineage for d1m9ua_ (1m9u A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465393Protein Elastase [50536] (4 species)
  7. 465394Species Earthworm (Eisenia fetida) [74973] (1 PDB entry)
    fibrinolytic enzyme component A
  8. 465395Domain d1m9ua_: 1m9u A: [74601]

Details for d1m9ua_

PDB Entry: 1m9u (more details), 2.3 Å

PDB Description: Crystal Structure of Earthworm Fibrinolytic Enzyme Component A from Eisenia fetida

SCOP Domain Sequences for d1m9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9ua_ b.47.1.2 (A:) Elastase {Earthworm (Eisenia fetida)}
viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
s

SCOP Domain Coordinates for d1m9ua_:

Click to download the PDB-style file with coordinates for d1m9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1m9ua_: