Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species) |
Species Escherichia coli [TaxId:562] [52322] (10 PDB entries) Uniprot P00907 |
Domain d1m6vb2: 1m6v B:153-380 [74543] Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vb1, d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd1, d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh1 complexed with adp, cl, k, mn, net, orn, po4; mutant |
PDB Entry: 1m6v (more details), 2.1 Å
SCOPe Domain Sequences for d1m6vb2:
Sequence, based on SEQRES records: (download)
>d1m6vb2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl fdgtlqgihrtdkpafsfqghpeaspfphdaaplfdhfielieqyrkt
>d1m6vb2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl fdgtlqgihrtdkpafsfqghpeaspaaplfdhfielieqyrkt
Timeline for d1m6vb2:
View in 3D Domains from other chains: (mouse over for more information) d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd1, d1m6vd2, d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vf2, d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh1, d1m6vh2 |