![]() | Class g: Small proteins [56992] (72 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein) |
![]() | Protein Integrin beta EGF-like domains [69941] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69942] (4 PDB entries) |
![]() | Domain d1m1xb4: 1m1x B:532-562 [74429] Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb3 |
PDB Entry: 1m1x (more details), 3.3 Å
SCOP Domain Sequences for d1m1xb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1xb4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens)} kgemcsghgqcscgdclcdsdwtgyycnctt
Timeline for d1m1xb4:
![]() Domains from same chain: (mouse over for more information) d1m1xb1, d1m1xb2, d1m1xb3, d1m1xb5 |
![]() Domains from other chains: (mouse over for more information) d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4 |