Lineage for d1m1xb4 (1m1x B:532-562)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202990Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 203221Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 203222Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 203223Species Human (Homo sapiens) [TaxId:9606] [69942] (4 PDB entries)
  8. 203224Domain d1m1xb4: 1m1x B:532-562 [74429]
    Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb3

Details for d1m1xb4

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

SCOP Domain Sequences for d1m1xb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xb4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens)}
kgemcsghgqcscgdclcdsdwtgyycnctt

SCOP Domain Coordinates for d1m1xb4:

Click to download the PDB-style file with coordinates for d1m1xb4.
(The format of our PDB-style files is described here.)

Timeline for d1m1xb4: