![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.15: Integrin domains [69179] (1 family) ![]() |
![]() | Family b.1.15.1: Integrin domains [69180] (2 proteins) |
![]() | Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries) |
![]() | Domain d1m1xa2: 1m1x A:599-737 [74423] Other proteins in same PDB: d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5 |
PDB Entry: 1m1x (more details), 3.3 Å
SCOP Domain Sequences for d1m1xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1xa2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)} dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq ssnlfdkvspvvshkvdla
Timeline for d1m1xa2: