Class g: Small proteins [56992] (61 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulphide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (4 proteins) |
Protein Insulin [56996] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56998] (53 PDB entries) |
Domain d1lw8.1: 1lw8 B:,A: [74297] |
PDB Entry: 1lw8 (more details), 2.5 Å
SCOP Domain Sequences for d1lw8.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1lw8.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens)} fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn
Timeline for d1lw8.1:
View in 3D Domains from other chains: (mouse over for more information) d1lw8.2, d1lw8.2, d1lw8.2, d1lw8.2 |