Lineage for d1lw8.1 (1lw8 B:,A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268578Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulphide-rich
  4. 268579Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 268580Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 268585Protein Insulin [56996] (3 species)
  7. 268595Species Human (Homo sapiens) [TaxId:9606] [56998] (53 PDB entries)
  8. 268670Domain d1lw8.1: 1lw8 B:,A: [74297]

Details for d1lw8.1

PDB Entry: 1lw8 (more details), 2.5 Å

PDB Description: Crystal structure of Allo-IleA2-insulin, an inactive chiral analogue

SCOP Domain Sequences for d1lw8.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lw8.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1lw8.1:

Click to download the PDB-style file with coordinates for d1lw8.1.
(The format of our PDB-style files is described here.)

Timeline for d1lw8.1: