Lineage for d1lvof_ (1lvo F:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 671623Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 671648Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
    contains an extra alpha-helical domain
  7. 671664Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (3 PDB entries)
  8. 671670Domain d1lvof_: 1lvo F: [74289]
    complexed with dox, mpd, so4

Details for d1lvof_

PDB Entry: 1lvo (more details), 1.96 Å

PDB Description: structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain
PDB Compounds: (F:) Replicase, hydrolase domain

SCOP Domain Sequences for d1lvof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvof_ b.47.1.4 (F:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv

SCOP Domain Coordinates for d1lvof_:

Click to download the PDB-style file with coordinates for d1lvof_.
(The format of our PDB-style files is described here.)

Timeline for d1lvof_: