SCOP 1.69: Domain d1luwb1: 1luw B:1-83

Lineage for d1luwb1 (1luw B:1-83)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (14 PDB entries)

8. Domain d1luwb1: 1luw B:1-83 [74269]
   Other proteins in same PDB: d1luwa2, d1luwb2

Details for d1luwb1

PDB Entry: 1luw, 2.3 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel

SCOP Domain Sequences for d1luwb1:

Sequence; same for both SEQRES and ATOM records:

>d1luwb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskqhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1luwb1:

• d1luwb1 first appeared in SCOP 1.61
  
• d1luwb1 appears in SCOP 1.67
  
• d1luwb1 appears in SCOP 1.71
  
• d1luwb1 appears in the current release, SCOPe 2.08