SCOP 1.61: Domain d1luvb2: 1luv B:84-198

Lineage for d1luvb2 (1luv B:84-198)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (11 PDB entries)

8. Domain d1luvb2: 1luv B:84-198 [74266]
   Other proteins in same PDB: d1luva1, d1luvb1

Details for d1luvb2

PDB Entry: 1luv, 1.85 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel

SCOP Domain Sequences for d1luvb2:

Sequence; same for both SEQRES and ATOM records:

>d1luvb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1luvb2:

• d1luvb2 is new in SCOP 1.61
  
• d1luvb2 appears in SCOP 1.63
  
• d1luvb2 appears in the current release, SCOPe 2.08