![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54724] (14 PDB entries) |
![]() | Domain d1luva2: 1luv A:84-198 [74264] Other proteins in same PDB: d1luva1, d1luvb1 |
PDB Entry: 1luv (more details), 1.85 Å
SCOP Domain Sequences for d1luva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luva2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk
Timeline for d1luva2: