SCOPe 2.04: Domain d1lsua_: 1lsu A:

Lineage for d1lsua_ (1lsu A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
   automatically mapped to Pfam PF02254

6. Protein Ktn bsu222 [75118] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)

8. Domain d1lsua_: 1lsu A: [74250]
   complexed with nai

Details for d1lsua_

PDB Entry: 1lsu, 2.85 Å

PDB Description: ktn bsu222 crystal structure in complex with nadh

PDB Compounds: (A:) Conserved hypothetical protein yuaA

SCOPe Domain Sequences for d1lsua_:

Sequence; same for both SEQRES and ATOM records:

>d1lsua_ c.2.1.9 (A:) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
dmgvkiaqslsden

Timeline for d1lsua_:

• d1lsua_ first appeared in SCOP 1.61
  
• d1lsua_ appears in SCOPe 2.03
  
• d1lsua_ appears in SCOPe 2.05
  
• d1lsua_ appears in the current release, SCOPe 2.08