SCOP 1.67: Domain d1lr5c_: 1lr5 C:

Lineage for d1lr5c_ (1lr5 C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (12 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Auxin binding protein [75030] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [75031] (2 PDB entries)

8. Domain d1lr5c_: 1lr5 C: [74217]

Details for d1lr5c_

PDB Entry: 1lr5, 1.9 Å

PDB Description: crystal structure of auxin binding protein

SCOP Domain Sequences for d1lr5c_:

Sequence; same for both SEQRES and ATOM records:

>d1lr5c_ b.82.1.2 (C:) Auxin binding protein {Maize (Zea mays)}
scvrdnslvrdisqmpqssygieglshitvagalnhgmkevevwlqtispgqrtpihrhs
ceevftvlkgkgtllmgssslkypgqpqeipffqnttfsipvndphqvwnsdehedlqvl
viisrppakiflyddwsmphtaavlkfpfvwdedcfeaak

Timeline for d1lr5c_:

• d1lr5c_ first appeared in SCOP 1.61
  
• d1lr5c_ appears in SCOP 1.65
  
• d1lr5c_ appears in SCOP 1.69
  
• d1lr5c_ appears in the current release, SCOPe 2.08