Class b: All beta proteins [48724] (141 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (12 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
Protein Auxin binding protein [75030] (1 species) |
Species Maize (Zea mays) [TaxId:4577] [75031] (2 PDB entries) |
Domain d1lr5c_: 1lr5 C: [74217] |
PDB Entry: 1lr5 (more details), 1.9 Å
SCOP Domain Sequences for d1lr5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lr5c_ b.82.1.2 (C:) Auxin binding protein {Maize (Zea mays)} scvrdnslvrdisqmpqssygieglshitvagalnhgmkevevwlqtispgqrtpihrhs ceevftvlkgkgtllmgssslkypgqpqeipffqnttfsipvndphqvwnsdehedlqvl viisrppakiflyddwsmphtaavlkfpfvwdedcfeaak
Timeline for d1lr5c_: