SCOPe 2.03: Domain d1lotb1: 1lot B:3-146

Lineage for d1lotb1 (1lot B:3-146)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (56 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d1lotb1: 1lot B:3-146 [74164]
   Other proteins in same PDB: d1lota1, d1lota2, d1lota3
   complexed with atp, ca, gol

Details for d1lotb1

PDB Entry: 1lot, 2.5 Å

PDB Description: crystal structure of the complex of actin with vitamin d-binding protein

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1lotb1:

Sequence, based on SEQRES records:

>d1lotb1 c.55.1.1 (B:3-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskr
giltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqi
mfetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1lotb1 c.55.1.1 (B:3-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dettalvcdngsglvkagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypieh
giitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamy
vaiqavlslyasg

Timeline for d1lotb1:

• d1lotb1 first appeared in SCOP 1.61
  
• d1lotb1 appears in SCOPe 2.02
  
• d1lotb1 appears in SCOPe 2.04
  
• d1lotb1 appears in the current release, SCOPe 2.08