Lineage for d1ln4a_ (1ln4 A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.68: IF3-like [55199] (4 superfamilies) 
Superfamily d.68.4: hypothetical protein YhbY [75471] (1 family) 
Family d.68.4.1: hypothetical protein YhbY [75472] (1 protein) Protein hypothetical protein YhbY [75473] (1 species) Species Escherichia coli [TaxId:562] [75474] (1 PDB entry) 
Domain d1ln4a_: 1ln4 A: [74043]
Details for d1ln4a_
PDB Entry: 1ln4 (more details), 1.5 Å
PDB Description: crystal structure of e. coli yhby
SCOP Domain Sequences for d1ln4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ln4a_ d.68.4.1 (A:) hypothetical protein YhbY {Escherichia coli}
mdlstkqkqhlkglahplkpvvllgsngltegvlaeieqalehhelikvkiatedretkt
liveaivretgacnvqvigktlvlyrptkerkislple
SCOP Domain Coordinates for d1ln4a_:
Click to download the PDB-style file with coordinates for d1ln4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ln4a_:
- d1ln4a_ is new in SCOP 1.61
- d1ln4a_ appears in SCOP 1.63
- d1ln4a_ appears in the current release, SCOPe 2.08, called d1ln4a1
View in 3D