Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Actin [53073] (7 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (56 PDB entries) Uniprot P02568 ! SQ 02568 |
Domain d1lcua1: 1lcu A:15-157 [73830] complexed with atp, ca, cl, lar |
PDB Entry: 1lcu (more details), 3.5 Å
SCOPe Domain Sequences for d1lcua1:
Sequence, based on SEQRES records: (download)
>d1lcua1 c.55.1.1 (A:15-157) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvvmgqgdsyvgdeaqskrgi ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf etfnvpamyvaiqavlslyasgr
>d1lcua1 c.55.1.1 (A:15-157) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrprhdsyvgdeaqskrgiltlkypiehg iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv aiqavlslyasgr
Timeline for d1lcua1: