Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c2 [46650] (8 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries) |
Domain d1l9jd_: 1l9j D: [73723] Other proteins in same PDB: d1l9jh1, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt1, d1l9jt2 complexed with bcl, bph, cl, fe2, hem, lda, u10 |
PDB Entry: 1l9j (more details), 3.25 Å
SCOPe Domain Sequences for d1l9jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9jd_ a.3.1.1 (D:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]} qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv avrp
Timeline for d1l9jd_: