SCOP 1.75: Domain d1l6ja1: 1l6j A:29-105

Lineage for d1l6ja1 (1l6j A:29-105)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.20: PGBD-like [47089] (1 superfamily)
   core: 3 helices; bundle, closed, left-handed twist; parallel

4. Superfamily a.20.1: PGBD-like [47090] (2 families)

5. Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)

6. Protein Gelatinase B (MMP-9) [74703] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74704] (1 PDB entry)

8. Domain d1l6ja1: 1l6j A:29-105 [73619]
   Other proteins in same PDB: d1l6ja2, d1l6ja3, d1l6ja4, d1l6ja5
   complexed with ca, zn

Details for d1l6ja1

PDB Entry: 1l6j, 2.5 Å

PDB Description: Crystal structure of human matrix metalloproteinase MMP9 (gelatinase B).

PDB Compounds: (A:) Matrix metalloproteinase-9

SCOP Domain Sequences for d1l6ja1:

Sequence, based on SEQRES records:

>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
vlfpgdlrtnltdrqlaeeylyrygytrvaemrgeskslgpallllqkqlslpetgelds
atlkamrtprcgvpdlg

Sequence, based on observed residues (ATOM records):

>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
vlfpgdlrtnltdrqlaeeylyrygytlgpallllqkqlslpetgeldsatlkamrtprc
gvpdlg

Timeline for d1l6ja1:

• d1l6ja1 first appeared in SCOP 1.61
  
• d1l6ja1 appears in SCOP 1.73
  
• d1l6ja1 appears in SCOPe 2.01
  
• d1l6ja1 appears in the current release, SCOPe 2.08