Lineage for d1l5ga4 (1l5g A:1-438)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565655Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 565830Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (1 family) (S)
  5. 565831Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein)
  6. 565832Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 565842Species Human (Homo sapiens), isoform V [TaxId:9606] [69321] (4 PDB entries)
  8. 565845Domain d1l5ga4: 1l5g A:1-438 [73584]
    Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5gb1, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5
    complexed with mn, mva, nag

Details for d1l5ga4

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand

SCOP Domain Sequences for d1l5ga4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5ga4 b.69.8.1 (A:1-438) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform V}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

SCOP Domain Coordinates for d1l5ga4:

Click to download the PDB-style file with coordinates for d1l5ga4.
(The format of our PDB-style files is described here.)

Timeline for d1l5ga4: