Lineage for d1l3wa3 (1l3w A:214-326)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373405Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2373406Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2373407Protein C-cadherin ectodomain [74851] (1 species)
    five-domain fragment
  7. 2373408Species African clawed frog (Xenopus laevis) [TaxId:8355] [74852] (1 PDB entry)
  8. 2373411Domain d1l3wa3: 1l3w A:214-326 [73555]
    complexed with ca, nag, ndg

Details for d1l3wa3

PDB Entry: 1l3w (more details), 3.08 Å

PDB Description: c-cadherin ectodomain
PDB Compounds: (A:) EP-cadherin

SCOPe Domain Sequences for d1l3wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]}
andnapifdpktytalvpeneigfevqrlsvtdldmpgtpawqavykirvneggffnitt
dpesnqgilttakgldfelrkqyvlqitvenaepfsvplptstatvtvtvedv

SCOPe Domain Coordinates for d1l3wa3:

Click to download the PDB-style file with coordinates for d1l3wa3.
(The format of our PDB-style files is described here.)

Timeline for d1l3wa3: