SCOPe 2.04: Domain d1l2tb_: 1l2t B:

Lineage for d1l2tb_ (1l2t B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein MJ0796 [64027] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [64028] (2 PDB entries)

8. Domain d1l2tb_: 1l2t B: [73515]
   complexed with atp, ipa, na

Details for d1l2tb_

PDB Entry: 1l2t, 1.9 Å

PDB Description: dimeric structure of mj0796, a bacterial abc transporter cassette

PDB Compounds: (B:) hypothetical abc transporter ATP-binding protein mj0796

SCOPe Domain Sequences for d1l2tb_:

Sequence; same for both SEQRES and ATOM records:

>d1l2tb_ c.37.1.12 (B:) MJ0796 {Methanococcus jannaschii [TaxId: 2190]}
miklknvtktykmgeeiiyalknvnlnikegefvsimgpsgsgkstmlniigcldkpteg
evyidniktndldddeltkirrdkigfvfqqfnliplltalenvelplifkyrgamsgee
rrkraleclkmaeleerfanhkpnqlsggqqqrvaiaralannppiiladqptgaldskt
gekimqllkklneedgktvvvvthdinvarfgeriiylkdgevereeklrgf

Timeline for d1l2tb_:

• d1l2tb_ first appeared in SCOP 1.61
  
• d1l2tb_ appears in SCOPe 2.03
  
• d1l2tb_ appears in SCOPe 2.05
  
• d1l2tb_ appears in the current release, SCOPe 2.08