Lineage for d1kzga2 (1kzg A:819-965)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412584Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2412645Protein Dbl's big sister, Dbs [74989] (1 species)
  7. 2412646Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries)
    SQ Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence
  8. 2412649Domain d1kzga2: 1kzg A:819-965 [73356]
    Other proteins in same PDB: d1kzga1, d1kzgb_, d1kzgc1, d1kzgd_

Details for d1kzga2

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: dbscdc42(y889f)
PDB Compounds: (A:) guanine nucleotide exchange factor dbs

SCOPe Domain Sequences for d1kzga2:

Sequence, based on SEQRES records: (download)

>d1kzga2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
neirkvltsqlqacreasqhraleqsh

Sequence, based on observed residues (ATOM records): (download)

>d1kzga2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkgelarfkpmqrhlflhekavlfckkreengegy
ekapsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirk
vltsqlqacreasqhraleqsh

SCOPe Domain Coordinates for d1kzga2:

Click to download the PDB-style file with coordinates for d1kzga2.
(The format of our PDB-style files is described here.)

Timeline for d1kzga2: