Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins) automatically mapped to Pfam PF00891 |
Protein Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase [75259] (1 species) |
Species Alfalfa (Medicago sativa) [TaxId:3879] [75260] (2 PDB entries) |
Domain d1kyze2: 1kyz E:120-365 [73317] Other proteins in same PDB: d1kyza1, d1kyzc1, d1kyze1 complexed with fer, sah |
PDB Entry: 1kyz (more details), 2.2 Å
SCOPe Domain Sequences for d1kyze2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyze2 c.66.1.12 (E:120-365) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} dgvsisalnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkg msdhstitmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphvieda psypgvehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaeci lpvapdsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyim eflkkv
Timeline for d1kyze2:
View in 3D Domains from other chains: (mouse over for more information) d1kyza1, d1kyza2, d1kyzc1, d1kyzc2 |