Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily) 2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix |
Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) |
Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins) |
Protein Bifunctional dehydrogenase/ferrochelatase Met8p, dimerisation and C-terminal domains [75617] (1 species) involved in siroheme synthesis |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75618] (1 PDB entry) |
Domain d1kyqb2: 1kyq B:151-273 [73284] Other proteins in same PDB: d1kyqa1, d1kyqb1, d1kyqc1 complexed with nad |
PDB Entry: 1kyq (more details), 2.2 Å
SCOPe Domain Sequences for d1kyqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyqb2 e.37.1.1 (B:151-273) Bifunctional dehydrogenase/ferrochelatase Met8p, dimerisation and C-terminal domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ganleigdrlqilistnglsprfgalvrdeirnlftqmgdlaledavvklgelrrgirll apddkdvkyrmdwarrctdlfgiqhchnidvkrlldlfkvmfqeqncslqfpprerllse ycs
Timeline for d1kyqb2:
View in 3D Domains from other chains: (mouse over for more information) d1kyqa1, d1kyqa2, d1kyqc1, d1kyqc2 |