Lineage for d1kyac1 (1kya C:1-130)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553929Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 553970Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 553989Species Trametes versicolor, laccase 1 [TaxId:5325] [74871] (1 PDB entry)
  8. 553996Domain d1kyac1: 1kya C:1-130 [73209]

Details for d1kyac1

PDB Entry: 1kya (more details), 2.4 Å

PDB Description: active laccase from trametes versicolor complexed with 2,5-xylidine

SCOP Domain Sequences for d1kyac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyac1 b.6.1.3 (C:1-130) Laccase {Trametes versicolor, laccase 1}
gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks
tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl
rgpfvvydpn

SCOP Domain Coordinates for d1kyac1:

Click to download the PDB-style file with coordinates for d1kyac1.
(The format of our PDB-style files is described here.)

Timeline for d1kyac1: