Lineage for d1kyab1 (1kya B:1-130)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528133Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1528174Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 1528235Species Trametes versicolor, laccase 1 [TaxId:5325] [74871] (1 PDB entry)
  8. 1528239Domain d1kyab1: 1kya B:1-130 [73206]
    complexed with cu, nag, pye, xyd

Details for d1kyab1

PDB Entry: 1kya (more details), 2.4 Å

PDB Description: active laccase from trametes versicolor complexed with 2,5-xylidine
PDB Compounds: (B:) laccase

SCOPe Domain Sequences for d1kyab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyab1 b.6.1.3 (B:1-130) Laccase {Trametes versicolor, laccase 1 [TaxId: 5325]}
gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks
tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl
rgpfvvydpn

SCOPe Domain Coordinates for d1kyab1:

Click to download the PDB-style file with coordinates for d1kyab1.
(The format of our PDB-style files is described here.)

Timeline for d1kyab1: