SCOPe 2.04: Domain d1kwzb1: 1kwz B:105-221

Lineage for d1kwzb1 (1kwz B:105-221)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1kwzb1: 1kwz B:105-221 [73123]
   Other proteins in same PDB: d1kwza2, d1kwzb2, d1kwzc2
   complexed with ca, cl

Details for d1kwzb1

PDB Entry: 1kwz, 1.9 Å

PDB Description: rat mannose protein a (h189v) complexed with man-a13-man

PDB Compounds: (B:) mannose-binding protein a

SCOPe Domain Sequences for d1kwzb1:

Sequence; same for both SEQRES and ATOM records:

>d1kwzb1 d.169.1.1 (B:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndvgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1kwzb1:

• d1kwzb1 first appeared in SCOP 1.61
  
• d1kwzb1 appears in SCOPe 2.03
  
• d1kwzb1 appears in SCOPe 2.05
  
• d1kwzb1 appears in the current release, SCOPe 2.08