Lineage for d1kwta1 (1kwt A:105-221)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198738Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 198739Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 198740Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 198806Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 198809Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 198851Domain d1kwta1: 1kwt A:105-221 [73085]
    Other proteins in same PDB: d1kwta2, d1kwtb2, d1kwtc2

Details for d1kwta1

PDB Entry: 1kwt (more details), 1.95 Å

PDB Description: Rat mannose binding protein A (native, MPD)

SCOP Domain Sequences for d1kwta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwta1 d.169.1.1 (A:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOP Domain Coordinates for d1kwta1:

Click to download the PDB-style file with coordinates for d1kwta1.
(The format of our PDB-style files is described here.)

Timeline for d1kwta1: