SCOPe 2.03: Domain d1kufa_: 1kuf A:

Lineage for d1kufa_ (1kuf A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
   Pfam PF01421

6. Protein Snake venom metalloprotease [55520] (7 species)

7. Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries)

8. Domain d1kufa_: 1kuf A: [73007]
   complexed with cd

Details for d1kufa_

PDB Entry: 1kuf, 1.35 Å

PDB Description: High-resolution Crystal Structure of a Snake Venom Metalloproteinase from Taiwan Habu

PDB Compounds: (A:) metalloproteinase

SCOPe Domain Sequences for d1kufa_:

Sequence; same for both SEQRES and ATOM records:

>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]}
qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
skdyyqtfltndnpqcilnap

Timeline for d1kufa_:

• d1kufa_ first appeared in SCOP 1.61
  
• d1kufa_ appears in SCOPe 2.02
  
• d1kufa_ appears in SCOPe 2.04
  
• d1kufa_ appears in the current release, SCOPe 2.08