Lineage for d1ktdc2 (1ktd C:1-81)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642339Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1642454Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)
  8. 1642462Domain d1ktdc2: 1ktd C:1-81 [72969]
    Other proteins in same PDB: d1ktda1, d1ktdb1, d1ktdb2, d1ktdc1, d1ktdd1, d1ktdd2
    complexed with nag, so4

Details for d1ktdc2

PDB Entry: 1ktd (more details), 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide
PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-D alpha chain

SCOPe Domain Sequences for d1ktdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktdc2 d.19.1.1 (C:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOPe Domain Coordinates for d1ktdc2:

Click to download the PDB-style file with coordinates for d1ktdc2.
(The format of our PDB-style files is described here.)

Timeline for d1ktdc2: