Class b: All beta proteins [48724] (178 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins) this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain |
Protein Galactoside acetyltransferase [75028] (1 species) |
Species Escherichia coli [TaxId:562] [75029] (4 PDB entries) |
Domain d1krra_: 1krr A: [72899] complexed with aco |
PDB Entry: 1krr (more details), 2.5 Å
SCOPe Domain Sequences for d1krra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv ireindrdkhyyfkdykves
Timeline for d1krra_: