Lineage for d1klza_ (1klz A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) 
Family c.1.2.3: Decarboxylase [51375] (2 proteins) Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species) Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries) 
Domain d1klza_: 1klz A: [72731]
Details for d1klza_
PDB Entry: 1klz (more details), 1.5 Å
PDB Description: crystal structure of orotidine monophosphate decarboxylase mutant d70a complexed with ump
SCOP Domain Sequences for d1klza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klza_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiaafkv
adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem
fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl
rfadaiivgrsiyladnpaaaaagiiesi
SCOP Domain Coordinates for d1klza_:
Click to download the PDB-style file with coordinates for d1klza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1klza_:
- d1klza_ is new in SCOP 1.61
- d1klza_ appears in SCOP 1.63
- d1klza_ appears in the current release, SCOPe 2.08
View in 3D