Lineage for d1klfd2 (1klf D:159-279)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377244Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2377265Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2377266Species Escherichia coli [TaxId:562] [49407] (25 PDB entries)
  8. 2377306Domain d1klfd2: 1klf D:159-279 [72689]
    Other proteins in same PDB: d1klfa1, d1klfa2, d1klfc1, d1klfc2, d1klfe1, d1klfe2, d1klfg1, d1klfg2, d1klfi1, d1klfi2, d1klfk1, d1klfk2, d1klfm1, d1klfm2, d1klfo1, d1klfo2
    complexed with man

Details for d1klfd2

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose
PDB Compounds: (D:) FimH PROTEIN

SCOPe Domain Sequences for d1klfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfd2 b.2.3.2 (D:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d1klfd2:

Click to download the PDB-style file with coordinates for d1klfd2.
(The format of our PDB-style files is described here.)

Timeline for d1klfd2: