Lineage for d1kkja_ (1kkj A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) 
Family c.67.1.4: omega-Amino acid:pyruvate aminotransferase-like [53417] (12 proteins) 
Protein Serine hydroxymethyltransferase [53429] (5 species) Species Bacillus stearothermophilus [TaxId:1422] [75272] (4 PDB entries) 
Domain d1kkja_: 1kkj A: [72647]
Details for d1kkja_
PDB Entry: 1kkj (more details), 1.93 Å
PDB Description: Crystal Structure of Serine Hydroxymethyltransferase from B.stearothermophilus
SCOP Domain Sequences for d1kkja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkja_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd
SCOP Domain Coordinates for d1kkja_:
Click to download the PDB-style file with coordinates for d1kkja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kkja_:
- d1kkja_ is new in SCOP 1.61
- d1kkja_ appears in SCOP 1.63
- d1kkja_ appears in the current release, SCOPe 2.08
View in 3D