Lineage for d1kk2a3 (1kk2 A:6-200)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830286Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family ((144211))
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family ((144211))
  7. 830289Species Archaeon Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries)
  8. 830294Domain d1kk2a3: 1kk2 A:6-200 [72639]
    Other proteins in same PDB: d1kk2a1, d1kk2a2
    complexed with gdp, mg, zn; mutant

Details for d1kk2a3

PDB Entry: 1kk2 (more details), 2.1 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+
PDB Compounds: (A:) eIF2gamma

SCOP Domain Sequences for d1kk2a3:

Sequence, based on SEQRES records: (download)

>d1kk2a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]}
srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
nidvlvkaiedfipt

Sequence, based on observed residues (ATOM records): (download)

>d1kk2a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]}
srqaevnigmvghvdhgkttltkaltgvwtdseelrrgitikigfadaeirrcpncgrys
tspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtre
hlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgani
dvlvkaiedfipt

SCOP Domain Coordinates for d1kk2a3:

Click to download the PDB-style file with coordinates for d1kk2a3.
(The format of our PDB-style files is described here.)

Timeline for d1kk2a3: