Lineage for d1kk2a3 (1kk2 A:6-200)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179578Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (1 species)
  7. 179579Species Archaeon Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries)
  8. 179584Domain d1kk2a3: 1kk2 A:6-200 [72639]
    Other proteins in same PDB: d1kk2a1, d1kk2a2

Details for d1kk2a3

PDB Entry: 1kk2 (more details), 2.1 Å

PDB Description: Structure of the large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi-G235D mutant complexed with GDP-Mg2+

SCOP Domain Sequences for d1kk2a3:

Sequence, based on SEQRES records: (download)

>d1kk2a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi}
srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
nidvlvkaiedfipt

Sequence, based on observed residues (ATOM records): (download)

>d1kk2a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi}
srqaevnigmvghvdhgkttltkaltgvwtdseelrrgitikigfadaeirrcpncgrys
tspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtre
hlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgani
dvlvkaiedfipt

SCOP Domain Coordinates for d1kk2a3:

Click to download the PDB-style file with coordinates for d1kk2a3.
(The format of our PDB-style files is described here.)

Timeline for d1kk2a3: