Lineage for d1kjya1 (1kjy A:61-181)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330344Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2330345Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2330346Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2330347Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2330398Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)
  8. 2330414Domain d1kjya1: 1kjy A:61-181 [72624]
    Other proteins in same PDB: d1kjya2, d1kjya3, d1kjyc2
    bound to the goloco motif of rgs14, chains B and D
    complexed with cs, gdp, mg

Details for d1kjya1

PDB Entry: 1kjy (more details), 2.7 Å

PDB Description: Crystal Structure of Human G[alpha]i1 Bound to the GoLoco Motif of RGS14
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1kjya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjya1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOPe Domain Coordinates for d1kjya1:

Click to download the PDB-style file with coordinates for d1kjya1.
(The format of our PDB-style files is described here.)

Timeline for d1kjya1: