Lineage for d1kiue2 (1kiu E:122-205)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382837Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2382838Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2382856Protein FimC [49588] (1 species)
  7. 2382857Species Escherichia coli [TaxId:562] [49589] (9 PDB entries)
  8. 2382884Domain d1kiue2: 1kiu E:122-205 [72532]
    Other proteins in same PDB: d1kiua1, d1kiub1, d1kiub2, d1kiuc1, d1kiud1, d1kiud2, d1kiue1, d1kiuf1, d1kiuf2, d1kiug1, d1kiuh1, d1kiuh2, d1kiui1, d1kiuj1, d1kiuj2, d1kiuk1, d1kiul1, d1kiul2, d1kium1, d1kiun1, d1kiun2, d1kiuo1, d1kiup1, d1kiup2
    complexed with mma; mutant

Details for d1kiue2

PDB Entry: 1kiu (more details), 3 Å

PDB Description: fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d- mannose
PDB Compounds: (E:) chaperone protein fimc

SCOPe Domain Sequences for d1kiue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kiue2 b.7.2.1 (E:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d1kiue2:

Click to download the PDB-style file with coordinates for d1kiue2.
(The format of our PDB-style files is described here.)

Timeline for d1kiue2: