SCOP 1.69: Domain d1kile_: 1kil E:

Lineage for d1kile_ (1kil E:)

1. Root: SCOP 1.69

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (1 family)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (11 proteins)

6. Protein Complexin [88921] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88922] (1 PDB entry)

8. Domain d1kile_: 1kil E: [72522]
   Other proteins in same PDB: d1kila_, d1kilb_, d1kilc_, d1kild_
   complex with SNAP25, synaptobrevin and syntaxin fragments

Details for d1kile_

PDB Entry: 1kil, 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex

SCOP Domain Sequences for d1kile_:

Sequence; same for both SEQRES and ATOM records:

>d1kile_ h.1.15.1 (E:) Complexin {Rat (Rattus norvegicus)}
kkeeerqealrqaeeerkakyakmeaerevmrqgirdkygi

Timeline for d1kile_:

• d1kile_ first appeared in SCOP 1.61
  
• d1kile_ appears in SCOP 1.67
  
• d1kile_ appears in SCOP 1.71
  
• d1kile_ appears in the current release, SCOPe 2.08