Lineage for d1kile_ (1kil E:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205391Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
  4. 205869Superfamily h.1.15: Neuronal synaptic fusion complex [58038] (1 family) (S)
  5. 205870Family h.1.15.1: Neuronal synaptic fusion complex [58039] (1 protein)
  6. 205871Protein Neuronal synaptic fusion complex [58040] (4 species)
  7. 205872Species Human (Homo sapiens)/Rat (Rattus norvegicus) [75702] (1 PDB entry)
  8. 205877Domain d1kile_: 1kil E: [72522]

Details for d1kile_

PDB Entry: 1kil (more details), 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex

SCOP Domain Sequences for d1kile_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kile_ h.1.15.1 (E:) Neuronal synaptic fusion complex {Human (Homo sapiens)/Rat (Rattus norvegicus)}
kkeeerqealrqaeeerkakyakmeaerevmrqgirdkygi

SCOP Domain Coordinates for d1kile_:

Click to download the PDB-style file with coordinates for d1kile_.
(The format of our PDB-style files is described here.)

Timeline for d1kile_: