Lineage for d1kflb_ (1kfl B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237126Superfamily c.1.10: Aldolase [51569] (4 families) (S)
    Common fold covers whole protein structure
  5. 237342Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 237343Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (2 species)
  7. 237344Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (3 PDB entries)
  8. 237354Domain d1kflb_: 1kfl B: [72414]

Details for d1kflb_

PDB Entry: 1kfl (more details), 2.8 Å

PDB Description: Crystal structure of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from E.coli complexed with Mn2+, PEP, and Phe

SCOP Domain Sequences for d1kflb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kflb_ c.1.10.4 (B:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme}
mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOP Domain Coordinates for d1kflb_:

Click to download the PDB-style file with coordinates for d1kflb_.
(The format of our PDB-style files is described here.)

Timeline for d1kflb_: