Lineage for d1kfla_ (1kfl A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174007Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 174217Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 174218Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (1 species)
  7. 174219Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (3 PDB entries)
  8. 174228Domain d1kfla_: 1kfl A: [72413]

Details for d1kfla_

PDB Entry: 1kfl (more details), 2.8 Å

PDB Description: Crystal structure of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from E.coli complexed with Mn2+, PEP, and Phe

SCOP Domain Sequences for d1kfla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfla_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme}
mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOP Domain Coordinates for d1kfla_:

Click to download the PDB-style file with coordinates for d1kfla_.
(The format of our PDB-style files is described here.)

Timeline for d1kfla_: