Lineage for d1kene_ (1ken E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2776004Domain d1kene_: 1ken E: [72377]
    Other proteins in same PDB: d1kenb_, d1kend_, d1kenf_, d1kenh1, d1kenh2, d1kenl1, d1kenl2, d1kent1, d1kent2, d1kenu1, d1kenu2

Details for d1kene_

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d1kene_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kene_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekqt

SCOPe Domain Coordinates for d1kene_:

Click to download the PDB-style file with coordinates for d1kene_.
(The format of our PDB-style files is described here.)

Timeline for d1kene_: