SCOPe 2.03: Domain d1kdsa_: 1kds A:

Lineage for d1kdsa_ (1kds A:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (73 PDB entries)

8. Domain d1kdsa_: 1kds A: [72354]
   complexed with npb

Details for d1kdsa_

PDB Entry: 1kds, 2.15 Å

PDB Description: X-ray crystal structure of AmpC beta-lactamase from E. coli in complex with the inhibitor 3-nitrophenylboronic acid

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1kdsa_:

Sequence; same for both SEQRES and ATOM records:

>d1kdsa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1kdsa_:

• d1kdsa_ first appeared in SCOP 1.61
  
• d1kdsa_ appears in SCOPe 2.02
  
• d1kdsa_ appears in SCOPe 2.04
  
• d1kdsa_ appears in the current release, SCOPe 2.08