SCOP 1.61: Domain d1k8yb_: 1k8y B:

Lineage for d1k8yb_ (1k8y B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (27 PDB entries)

8. Domain d1k8yb_: 1k8y B: [72184]
   Other proteins in same PDB: d1k8ya_

Details for d1k8yb_

PDB Entry: 1k8y, 1.5 Å

PDB Description: crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with d,l-alpha-glycerol-3-phosphate

SCOP Domain Sequences for d1k8yb_:

Sequence; same for both SEQRES and ATOM records:

>d1k8yb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwpgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d1k8yb_:

• d1k8yb_ is new in SCOP 1.61
  
• d1k8yb_ appears in SCOP 1.63
  
• d1k8yb_ appears in the current release, SCOPe 2.08