Lineage for d1k8ha_ (1k8h A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430448Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 2430449Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 2430450Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 2430451Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 2430452Species Aquifex aeolicus [TaxId:63363] [74985] (2 PDB entries)
  8. 2430455Domain d1k8ha_: 1k8h A: [72176]

Details for d1k8ha_

PDB Entry: 1k8h (more details)

PDB Description: nmr structure of small protein b (smpb) from aquifex aeolicus
PDB Compounds: (A:) Small Protein B

SCOPe Domain Sequences for d1k8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ha_ b.111.1.1 (A:) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]}
gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
lialakgkklydr

SCOPe Domain Coordinates for d1k8ha_:

Click to download the PDB-style file with coordinates for d1k8ha_.
(The format of our PDB-style files is described here.)

Timeline for d1k8ha_: