Lineage for d1k8cc_ (1k8c C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173138Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 173139Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (8 proteins)
  6. 173201Protein Xylose reductase [75058] (1 species)
  7. 173202Species Fungi (Candida tenuis) [TaxId:45596] [75059] (2 PDB entries)
  8. 173207Domain d1k8cc_: 1k8c C: [72174]

Details for d1k8cc_

PDB Entry: 1k8c (more details), 2.1 Å

PDB Description: Crystal structure of dimeric xylose reductase in complex with NADP(H)

SCOP Domain Sequences for d1k8cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8cc_ c.1.7.1 (C:) Xylose reductase {Fungi (Candida tenuis)}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

SCOP Domain Coordinates for d1k8cc_:

Click to download the PDB-style file with coordinates for d1k8cc_.
(The format of our PDB-style files is described here.)

Timeline for d1k8cc_: