Lineage for d1k8aq_ (1k8a Q:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446210Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 446211Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 446212Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 446213Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 446214Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (19 PDB entries)
  8. 446226Domain d1k8aq_: 1k8a Q: [72161]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_

Details for d1k8aq_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k8aq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8aq_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1k8aq_:

Click to download the PDB-style file with coordinates for d1k8aq_.
(The format of our PDB-style files is described here.)

Timeline for d1k8aq_: