Lineage for d1jr9a1 (1jr9 A:2-91)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) 
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) Protein Mn superoxide dismutase (MnSOD) [46618] (6 species) 
Species Bacillus halodenitrificans [TaxId:1482] [74665] (1 PDB entry) 
Domain d1jr9a1: 1jr9 A:2-91 [71822]
Other proteins in same PDB: d1jr9a2
Details for d1jr9a1
PDB Entry: 1jr9 (more details), 2.8 Å
PDB Description: Crystal Structure of manganese superoxide dismutases from Bacillus halodenitrificans
SCOP Domain Sequences for d1jr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans}
kfelpelpyaydaleptidketmnihhtkhhntyvtklngaleghedlknkslndlisnl
davpenirtavrnnggghanhslfwklmsp
SCOP Domain Coordinates for d1jr9a1:
Click to download the PDB-style file with coordinates for d1jr9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jr9a1:
- d1jr9a1 is new in SCOP 1.61
- d1jr9a1 appears in SCOP 1.63
- d1jr9a1 appears in the current release, SCOPe 2.08
View in 3D
