Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Adenylylsulfate reductase B subunit [69726] (1 species) includes N-terminal partly folded tail |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (2 PDB entries) |
Domain d1jnzd_: 1jnz D: [71773] Other proteins in same PDB: d1jnza1, d1jnza2, d1jnza3, d1jnzc1, d1jnzc2, d1jnzc3 complexed with fad, fs4, so3 |
PDB Entry: 1jnz (more details), 2.5 Å
SCOP Domain Sequences for d1jnzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnzd_ d.58.1.5 (D:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus} psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep teealksellagepeiigtsefpqvkkka
Timeline for d1jnzd_: