SCOPe 2.07: Domain d1jlwa1: 1jlw A:91-217

Lineage for d1jlwa1 (1jlw A:91-217)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class delta GST [81355] (6 species)
   formerly a part of class theta enzymes

7. Species Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId:123217] [74725] (1 PDB entry)

8. Domain d1jlwa1: 1jlw A:91-217 [71741]
   Other proteins in same PDB: d1jlwa2, d1jlwb2

Details for d1jlwa1

PDB Entry: 1jlw, 2.45 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-4

PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d1jlwa1:

Sequence; same for both SEQRES and ATOM records:

>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryft

Timeline for d1jlwa1:

• d1jlwa1 first appeared in SCOP 1.61
  
• d1jlwa1 appears in SCOPe 2.06
  
• d1jlwa1 appears in the current release, SCOPe 2.08